PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0087s0080.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 368aa    MW: 41227.9 Da    PI: 8.1169
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0087s0080.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.75.5e-2576119144
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                             d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg++rsrk++e
  SapurV1A.0087s0080.2.p  76 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE 119
                             79***************************************997 PP

2QLQ606.8e-211044236
                     QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                            +FTa+Q+q+L++Q+l+yKy++++ P+Pp+Ll+ i+
  SapurV1A.0087s0080.2.p 10 PFTASQWQELEHQALIYKYMVSGIPIPPDLLLTIK 44
                            8******************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.2E-12945IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-151043IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.9571045IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.9876120IPR014977WRC domain
PfamPF088791.3E-2077119IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MIMSAGNRFP FTASQWQELE HQALIYKYMV SGIPIPPDLL LTIKRSACLD SSKLFPRQHP  60
HFAWSCFQMG SGRAMDPEPG RCRRTDGKKW RCSKEAYPDS KYCERHMHRG KNRSRKPVEV  120
ATQTQSTTSP AVSSITRNHS NNSLLTASSL SLSFSLSPET HHQNRFHYPA GYHAHPNHPL  180
FSSSTPTGTG LSPQEDSTHL LLDSGGSSMT SNTDFRRNVY GLKEEVDEHA FFSEPSGSMR  240
SLSGSSLDDA WQLTPLTMNS SSSSSSNNSS KQRNLSSLQT EYSYLQLQSL CDHDTPKQQK  300
QLRHNCLLGN DGSNLGPMKM EKEEPQKTVH RFFDEWPPNI KESWLELDDK SSNSASVSAL  360
NIHSFII*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1826621e-169AC182662.2 Populus trichocarpa clone Pop1-15O24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006372002.10.0hypothetical protein POPTR_0018s07140g
TrEMBLU5FHP90.0U5FHP9_POPTR; Uncharacterized protein
STRINGPOPTR_0018s07140.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.14e-52growth-regulating factor 5